Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 488 (Olfr488)

This Recombinant Mouse Olfactory receptor 488 (Olfr488) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 488, Olfactory receptor 204-15

UniProt

Q8VG02

Expression Region

1-314

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFLDNGNHTAVTEFILLGLTDDPFLRIVLFSIILCIYLVTVFGNLSTILLIRVSSQLHH PMYFFLSHLATVDLGISSSVTPSMLVNFLAERSTISYLGCGIQLSSAALFGTLECFLLAV MAYDRFMAICNPLLYSTKLSTRFCIQLVVGSYIGAFLNDSCYILSFAFFLFCGPNKVDHF FCDLSPMMELSCSDASVSGVVISFTAGSITMTTLIVIVISYFYILITILKMRSTEGRQKA FSTCTSHLTAVTLYYGTIIFIYVMPKSTYSRDQNKVVSLFYMVVIPMLNPLIYSLRNNEI KGALKKQFYRKTLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human OR51B6 sgRNA gene knockout kit - Lentiviral human OR51B6 sgRNA gene knockout kit (plasmid)
GTR15357608 1 Vial

Lentiviral human OR51B6 sgRNA gene knockout kit - Lentiviral human OR51B6 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Slc4a8 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7231704 1.0 µg DNA

Slc4a8 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Mouse C Terminal Telopeptide of Type I Collagen (CTX) ELISA Kit
MBS9901663-01 48 Well

Mouse C Terminal Telopeptide of Type I Collagen (CTX) ELISA Kit

Sign In for Pricing
View Details
Mouse C Terminal Telopeptide of Type I Collagen (CTX) ELISA Kit
MBS9901663-02 96 Well

Mouse C Terminal Telopeptide of Type I Collagen (CTX) ELISA Kit

Sign In for Pricing
View Details
Mouse C Terminal Telopeptide of Type I Collagen (CTX) ELISA Kit
MBS9901663-03 5x 96 Well

Mouse C Terminal Telopeptide of Type I Collagen (CTX) ELISA Kit

Sign In for Pricing
View Details
Mouse C Terminal Telopeptide of Type I Collagen (CTX) ELISA Kit
MBS9901663-04 10x 96 Well

Mouse C Terminal Telopeptide of Type I Collagen (CTX) ELISA Kit

Sign In for Pricing
View Details