Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes Olfactory receptor 1E2 (OR1E2)

This Recombinant Pan troglodytes Olfactory receptor 1E2 (OR1E2) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 1E2, Olfactory receptor 1E4

UniProt

Q9TUA2

Expression Region

1-314

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPMY LFLSNLSFSDLCFSSVTIPKLLQNMQNQDPSIPYADCLTQMHFFLLFGDLESFLLVAMAY DRYVAICFPLHYTAIMSPMLCLSVVALSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCD MSALLKLACSDTRVNEWVIFIMGGLIVVIPFLLILGSYARIVSSILKVPSFKGICKALST CGSHLSVVSLFYGTVIGLYLCPSANSSTLKDTVMAMMYTVVTPMLNPFIYSLRNRDMKGA LERVICKRKNPFLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

March2 (NM_145486) Mouse Tagged Lenti ORF Clone
MR216574L3 10 µg

March2 (NM_145486) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Zcchc12 Mouse shRNA Lentiviral Particle (Locus ID 72693)
TL504763V 500 µL Each

Zcchc12 Mouse shRNA Lentiviral Particle (Locus ID 72693)

Sign In for Pricing
View Details
N-Cyclopropyl-4-fluoroaniline
PC449022 1 Each

N-Cyclopropyl-4-fluoroaniline

Sign In for Pricing
View Details
NRM Knockout NCI-H1299 Polyclonal Cells
ARG17989 1 Million

NRM Knockout NCI-H1299 Polyclonal Cells

Sign In for Pricing
View Details
Lentiviral mouse Shank1 shRNA (UAS) - Lentiviral mouse Shank1 shRNA (UAS, RFP) (25)
GTR15185411 1 Vial

Lentiviral mouse Shank1 shRNA (UAS) - Lentiviral mouse Shank1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Human Interleukin 25 (IL-25) ELISA Kit
GA-E0094HM-01 48 Tests

Human Interleukin 25 (IL-25) ELISA Kit

Sign In for Pricing
View Details