Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes Olfactory receptor 1E2 (OR1E2)

This Recombinant Pan troglodytes Olfactory receptor 1E2 (OR1E2) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 1E2, Olfactory receptor 1E4

UniProt

Q9TUA2

Expression Region

1-314

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPMY LFLSNLSFSDLCFSSVTIPKLLQNMQNQDPSIPYADCLTQMHFFLLFGDLESFLLVAMAY DRYVAICFPLHYTAIMSPMLCLSVVALSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCD MSALLKLACSDTRVNEWVIFIMGGLIVVIPFLLILGSYARIVSSILKVPSFKGICKALST CGSHLSVVSLFYGTVIGLYLCPSANSSTLKDTVMAMMYTVVTPMLNPFIYSLRNRDMKGA LERVICKRKNPFLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF793 Antibody
GWB-MR885C 50 µg

ZNF793 Antibody

Sign In for Pricing
View Details
ALDH3B1 Protein Vector (Mouse) (pPB-N-His)
PV153783 500 ng

ALDH3B1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
GScript First-Strand Synthesis Kit (20 uL for each total RXN volume)
MB305-0050 50 Reactions

GScript First-Strand Synthesis Kit (20 uL for each total RXN volume)

Sign In for Pricing
View Details
DUS3L (tRNA-Dihydrouridine (47) Synthase [NAD (P) (+) ]-like) )
479718 100 µL

DUS3L (tRNA-Dihydrouridine (47) Synthase [NAD (P) (+) ]-like) )

Sign In for Pricing
View Details
DNAJC11, NT (DNAJC11, DnaJ homolog subfamily C member 11) (AP)
MBS6292740-01 0.2 mL

DNAJC11, NT (DNAJC11, DnaJ homolog subfamily C member 11) (AP)

Sign In for Pricing
View Details
DNAJC11, NT (DNAJC11, DnaJ homolog subfamily C member 11) (AP)
MBS6292740-02 5x 0.2 mL

DNAJC11, NT (DNAJC11, DnaJ homolog subfamily C member 11) (AP)

Sign In for Pricing
View Details