Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes Olfactory receptor 1E2 (OR1E2)

This Recombinant Pan troglodytes Olfactory receptor 1E2 (OR1E2) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 1E2, Olfactory receptor 1E4

UniProt

Q9TUA2

Expression Region

1-314

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPMY LFLSNLSFSDLCFSSVTIPKLLQNMQNQDPSIPYADCLTQMHFFLLFGDLESFLLVAMAY DRYVAICFPLHYTAIMSPMLCLSVVALSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCD MSALLKLACSDTRVNEWVIFIMGGLIVVIPFLLILGSYARIVSSILKVPSFKGICKALST CGSHLSVVSLFYGTVIGLYLCPSANSSTLKDTVMAMMYTVVTPMLNPFIYSLRNRDMKGA LERVICKRKNPFLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3a,6a-dimethyl-3,6-diphenyl-1,4-di[ (1,1,1-trimethylsilyl) oxy]perhydropentalene-1,4-dicarbonitrile
OR22759 1 Each

3a,6a-dimethyl-3,6-diphenyl-1,4-di[ (1,1,1-trimethylsilyl) oxy]perhydropentalene-1,4-dicarbonitrile

Sign In for Pricing
View Details
Rat Phlda1 Pre-designed siRNA Set B
SI210421B 1 Each

Rat Phlda1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O1:K1/APEC CAIT Polyclonal Antibody
MBS7167165 Inquire

Rabbit anti-Escherichia coli O1:K1/APEC CAIT Polyclonal Antibody

Sign In for Pricing
View Details
G Antigen 7 (GAGE7) BioAssayTM ELISA Kit (Human) discontinued
587598 96 Tests

G Antigen 7 (GAGE7) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Neohelmanthicin B
T81688-01 5 mg

Neohelmanthicin B

Sign In for Pricing
View Details
Neohelmanthicin B
T81688-02 50 mg

Neohelmanthicin B

Sign In for Pricing
View Details