Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gorilla gorilla gorilla Olfactory receptor 1E1 (OR1E1)

This Recombinant Gorilla gorilla gorilla Olfactory receptor 1E1 (OR1E1) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 1E1

UniProt

Q9TU94

Expression Region

1-314

Origin

Gorilla gorilla gorilla (Lowland gorilla)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPMY LFLSNLSFSDLCFSSVTIPKLLQNMQNQDPSIPYADCLTQMYFFLLFGDLESFLLVAMAY DRYVAICFALHYTAIMSPMLCLSLVALSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCD MSALLKLACSDTRVNEWVIFIMGGLIVVIPFLLILGSYARIVSSILKVPSSKGICKAFST CGSHLSVVSLFYGTVIGLYLCPSANSSTLKETVMAMMYTVVTPMLNPFIYSLRNGDMKGA LSRVIHQKKTFFSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wheat Germ Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS
MGW11F-WG/W 10x 96 Well Plates

Wheat Germ Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS

Sign In for Pricing
View Details
CD34 (QBEnd/10 + HPCA1/763), Biotin conjugate, 0.1mg/mL
BNCB0904-100 1x 100 µL

CD34 (QBEnd/10 + HPCA1/763), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sodium Chloride, 500g
PC0914-500g 500 g

Sodium Chloride, 500g

Sign In for Pricing
View Details
ARHGEF37 (NM_001001669) Human Recombinant Protein
TP317628 20 µg

ARHGEF37 (NM_001001669) Human Recombinant Protein

Sign In for Pricing
View Details
5T4 (TPBG) Rabbit Polyclonal Antibody
TA382745 100 µL

5T4 (TPBG) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Celf3 Mouse Gene Knockout Kit (CRISPR)
KN503115 1 Kit

Celf3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details