Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gorilla gorilla gorilla Olfactory receptor 1E1 (OR1E1)

This Recombinant Gorilla gorilla gorilla Olfactory receptor 1E1 (OR1E1) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 1E1

UniProt

Q9TU94

Expression Region

1-314

Origin

Gorilla gorilla gorilla (Lowland gorilla)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPMY LFLSNLSFSDLCFSSVTIPKLLQNMQNQDPSIPYADCLTQMYFFLLFGDLESFLLVAMAY DRYVAICFALHYTAIMSPMLCLSLVALSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCD MSALLKLACSDTRVNEWVIFIMGGLIVVIPFLLILGSYARIVSSILKVPSSKGICKAFST CGSHLSVVSLFYGTVIGLYLCPSANSSTLKETVMAMMYTVVTPMLNPFIYSLRNGDMKGA LSRVIHQKKTFFSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MUC5AC Antibody (1-13M1) [Alexa Fluor 532]
NBP3-00536AF532 0.1 mL

Mouse Monoclonal MUC5AC Antibody (1-13M1) [Alexa Fluor 532]

Sign In for Pricing
View Details
PLB (phospho Ser16/T17) Polyclonal Antibody
13608-01 50 µL

PLB (phospho Ser16/T17) Polyclonal Antibody

Sign In for Pricing
View Details
PLB (phospho Ser16/T17) Polyclonal Antibody
13608-02 100 µL

PLB (phospho Ser16/T17) Polyclonal Antibody

Sign In for Pricing
View Details
RARγ (H-6) P
sc-398065 P 100 µg - 0.5 mL

RARγ (H-6) P

Sign In for Pricing
View Details
Marek’s Disease PCR Kit
VT040050T 50 Reactions

Marek’s Disease PCR Kit

Sign In for Pricing
View Details
Lentiviral mouse Polr2i shRNA (UAS) - Lentiviral mouse Polr2i shRNA (UAS, iRFP) (25)
GTR15210146 1 Vial

Lentiviral mouse Polr2i shRNA (UAS) - Lentiviral mouse Polr2i shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details