Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1E1 (OR1E1)

This Recombinant Human Olfactory receptor 1E1 (OR1E1) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 1E1, Olfactory receptor 13-66, OR13-66, Olfactory receptor 17-2/17-32, OR17-2, OR17-32, Olfactory receptor 1E5, Olfactory recep

UniProt

P30953

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPMY LFLSNLSFSDLCFSSVTIPKLLQNMQNQDPSIPYADCLTQMYFFLLFGDLESFLLVAMAY DRYVAICFPLHYTAIMSPMLCLALVALSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCD MSALLKLAFSDTRVNEWVIFIMGGLILVIPFLLILGSYARIVSSILKVPSSKGICKAFST CGSHLSVVSLFYGTVIGLYLCSSANSSTLKDTVMAMMYTVVTPMLNPFIYSLRNRDMKGA LSRVIHQKKTFFSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uvrag 3'UTR Lenti-reporter-Luc Vector
49404084 1.0 µg

Uvrag 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Lentiviral mouse Slc39a4 shRNA (UAS) - Lentiviral mouse Slc39a4 shRNA (UAS, iRFP) (25)
GTR15294113 1 Vial

Lentiviral mouse Slc39a4 shRNA (UAS) - Lentiviral mouse Slc39a4 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Rat Phospholipid Transfer Protein (PLTP) ELISA Kit
RD-PLTP-Ra-01 96 Tests

Rat Phospholipid Transfer Protein (PLTP) ELISA Kit

Sign In for Pricing
View Details
Rat Phospholipid Transfer Protein (PLTP) ELISA Kit
RD-PLTP-Ra-02 48 Tests

Rat Phospholipid Transfer Protein (PLTP) ELISA Kit

Sign In for Pricing
View Details
NR0B2 Over-expression Lysate Product
GWB-220F55 0.1 mg

NR0B2 Over-expression Lysate Product

Sign In for Pricing
View Details
Rabbit Polyclonal DCLK1 Antibody
NBP2-58700-25ul 25 µL

Rabbit Polyclonal DCLK1 Antibody

Sign In for Pricing
View Details