Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 10A3 (OR10A3)

This Recombinant Human Olfactory receptor 10A3 (OR10A3) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 10A3, HTPCRX12, Olfactory receptor OR11-97

UniProt

P58181

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRQNQSCVVEFILLGFSNFPELQVQLFGVFLVIYVVTLMGNAIITVIISLNQSLHVPMY LFLLNLSVVEVSFSAVITPEMLVVLSTEKTMISFVGCFAQMYFILLFGGTECFLLGAMAY DRFAAICHPLNYPVIMNRGVFMKLVIFSWISGIMVATVQTTWVFSFPFCGPNEINHLFCE TPPVLELVCADTFLFEIYAFTGTILIVMVPFLLILLSYIRVLFAILKMPSTTGRQKAFST CASHLTSVTLFYGTANMTYLQPKSGYSPETKKLISLAYTLLTPLLNPLIYSLRNSEMKRT LIKLWRRKVILHTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

a-Chloralose ("may contain up to xx % of beta anomer")
TRC-A576005-2.5G 2.5 g

a-Chloralose ("may contain up to xx % of beta anomer")

Sign In for Pricing
View Details
MSHR Antibody
8G396-AAT 50 µg

MSHR Antibody

Sign In for Pricing
View Details
Human Netrin 1 (Ntn1) ELISA Kit
RDR-Ntn1-Hu-01 96 Tests

Human Netrin 1 (Ntn1) ELISA Kit

Sign In for Pricing
View Details
Human Netrin 1 (Ntn1) ELISA Kit
RDR-Ntn1-Hu-02 48 Tests

Human Netrin 1 (Ntn1) ELISA Kit

Sign In for Pricing
View Details
APOL6 Polyclonal Antibody
E-AB-16261-01 20 µL

APOL6 Polyclonal Antibody

Sign In for Pricing
View Details
APOL6 Polyclonal Antibody
E-AB-16261-02 60 µL

APOL6 Polyclonal Antibody

Sign In for Pricing
View Details