Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6C6 (OR6C6)

This Recombinant Human Olfactory receptor 6C6 (OR6C6) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 6C6

UniProt

A6NF89

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNKSMEIEFILLGLTDDPQLQIVIFLFLFLNYTLSLMGNLIIIILTLLDPRLKTPMYFF LRNFSFLEVIFTTVCIPRFLITIVTRDKTISYNNCATQLFFILLPGVTEFYLLAAMSYDR YVAICKPLHYPIIMSSKVCYQLVLSSWVTGFLIIFPPLVMGLKLDFCASKTIDHFMCETS PILQISCTDTHVLELMSFTLAVVTLVVTLVLVILSYTCIIKTILKFSSAQQRNKAFSTCT SHMIVVSMTYGSCIFMYIKPSAKERVTVSKGVALLYTSIAPLLNPFIYTLRNQQVKEVFW DVLQKNLCFSKRPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SVOPL rabbit pAb
E44H14995 100 µL

SVOPL rabbit pAb

Sign In for Pricing
View Details
Recombinant Human Argininosuccinate Synthase 1
7-02492 10 µg

Recombinant Human Argininosuccinate Synthase 1

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Uncharacterized PPE family protein PPE14 (ppe14)
MBS1406578-01 0.02 mg (E-Coli)

Recombinant Mycobacterium tuberculosis Uncharacterized PPE family protein PPE14 (ppe14)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Uncharacterized PPE family protein PPE14 (ppe14)
MBS1406578-02 0.02 mg (Yeast)

Recombinant Mycobacterium tuberculosis Uncharacterized PPE family protein PPE14 (ppe14)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Uncharacterized PPE family protein PPE14 (ppe14)
MBS1406578-03 0.1 mg (E-Coli)

Recombinant Mycobacterium tuberculosis Uncharacterized PPE family protein PPE14 (ppe14)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Uncharacterized PPE family protein PPE14 (ppe14)
MBS1406578-04 0.1 mg (Yeast)

Recombinant Mycobacterium tuberculosis Uncharacterized PPE family protein PPE14 (ppe14)

Sign In for Pricing
View Details