Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Olfactory receptor 1 (Olfr1)

This Recombinant Rat Olfactory receptor 1 (Olfr1) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 1, Olfactory receptor 1469, Olfactory receptor HGL-SP1, Olfactory receptor OR5, Olfactory receptor-like protein I54

UniProt

P70526

Expression Region

1-314

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTERNQTVISQFLLLGLPIPPEHQHVFYALFLSMYLTTVLGNLIIIILILLDSHLHTPMY LFLSNLSFSDLCFSSVTMPKLLQNMQSQVPSIPYAGCLSQIYFFLFFGDLGNFLLVAMAY DRYVAICFPLHYMSIMSPKLCVSLVVLSWVLTTFHAMLHTLLMARLSFCEDNVIPHFFCD MSALLKLACSDTRVNEVVIFIVVSLFLVLPFALIIMSYVRIVSSILKVPSSQGIYKAFST CGSHLSVVSLFYGTVIGLYLCPSSNNSTVKETVMSLMYTVVTPMLNPFIYSLRNRDIKGA MERIFCKRKIQLNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Human CD2 Antibody[TS1/8]
E-AB-F1148C-01 20 Tests

FITC Anti-Human CD2 Antibody[TS1/8]

Sign In for Pricing
View Details
FITC Anti-Human CD2 Antibody[TS1/8]
E-AB-F1148C-02 100 Tests

FITC Anti-Human CD2 Antibody[TS1/8]

Sign In for Pricing
View Details
FITC Anti-Human CD2 Antibody[TS1/8]
E-AB-F1148C-03 2x 100 Tests

FITC Anti-Human CD2 Antibody[TS1/8]

Sign In for Pricing
View Details
Human ENDOD1 activation kit by CRISPRa
GA108001 1 Kit

Human ENDOD1 activation kit by CRISPRa

Sign In for Pricing
View Details
NELL1 Antibody (HRP)
KH-3428-01 50 μL

NELL1 Antibody (HRP)

Sign In for Pricing
View Details
NELL1 Antibody (HRP)
KH-3428-02 100 µL

NELL1 Antibody (HRP)

Sign In for Pricing
View Details