Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Olfactory receptor 1 (Olfr1)

This Recombinant Rat Olfactory receptor 1 (Olfr1) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 1, Olfactory receptor 1469, Olfactory receptor HGL-SP1, Olfactory receptor OR5, Olfactory receptor-like protein I54

UniProt

P70526

Expression Region

1-314

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTERNQTVISQFLLLGLPIPPEHQHVFYALFLSMYLTTVLGNLIIIILILLDSHLHTPMY LFLSNLSFSDLCFSSVTMPKLLQNMQSQVPSIPYAGCLSQIYFFLFFGDLGNFLLVAMAY DRYVAICFPLHYMSIMSPKLCVSLVVLSWVLTTFHAMLHTLLMARLSFCEDNVIPHFFCD MSALLKLACSDTRVNEVVIFIVVSLFLVLPFALIIMSYVRIVSSILKVPSSQGIYKAFST CGSHLSVVSLFYGTVIGLYLCPSSNNSTVKETVMSLMYTVVTPMLNPFIYSLRNRDIKGA MERIFCKRKIQLNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LTK (NM_002344) Human Over-expression Lysate
LC419388 20 µg

LTK (NM_002344) Human Over-expression Lysate

Sign In for Pricing
View Details
(S)-2-((S)-2-Amino-4-carboxybutanamido)pentanedioic Acid
TRC-A790273-50MG 50 mg

(S)-2-((S)-2-Amino-4-carboxybutanamido)pentanedioic Acid

Sign In for Pricing
View Details
Recombinant Human CCL14/HCC-3 Protein (His Tag)
PKSH032187-01 10 µg

Recombinant Human CCL14/HCC-3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CCL14/HCC-3 Protein (His Tag)
PKSH032187-02 50 µg

Recombinant Human CCL14/HCC-3 Protein (His Tag)

Sign In for Pricing
View Details
Ethyl Isobutyrylacetate-d6
TRC-E921302-50MG 50 mg

Ethyl Isobutyrylacetate-d6

Sign In for Pricing
View Details
GDF 9 (GDF9) (NM_001288827) Human Tagged ORF Clone
RG237749 10 µg

GDF 9 (GDF9) (NM_001288827) Human Tagged ORF Clone

Sign In for Pricing
View Details