Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Olfactory receptor-like protein I15

This Recombinant Rat Olfactory receptor-like protein I15 spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor-like protein I15

UniProt

P23274

Expression Region

1-314

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEENQTVISQFLLLFLPIPSEHQHVFYALFLSMYLTTVLGNLIIIILIHLDSHLHTPMY LFLSNLSFSDLCFSSVTMPKLLQNMQSQVPSIPFAGCLTQLYFYLYFADLESFLLVAMAY DRYVAICFPLHYMSIMSPKLCVSLVVLSWVLTTFHAMLHTLLMARLSFCADNMIPHFFCD ISPLLKLSCSDTHVNELVIFVMGGLVIVIPFVLIIVSYARVVASILKVPSVRGIHKIFST CGSHLSVVSLFYGTIIGLYLCPSANNSTVKETVMAMMYTVVTPMLNPFIYSLRNRDMKEA LIRVLCKKKITFCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-STON2 Antibody
CTA4974-01 30 µL

Anti-STON2 Antibody

Sign In for Pricing
View Details
Anti-STON2 Antibody
CTA4974-02 50 μL

Anti-STON2 Antibody

Sign In for Pricing
View Details
Anti-STON2 Antibody
CTA4974-03 100 µL

Anti-STON2 Antibody

Sign In for Pricing
View Details
Anti-STON2 Antibody
CTA4974-04 200 µL

Anti-STON2 Antibody

Sign In for Pricing
View Details
AXL Antibody
A49945-100UG 100 µg

AXL Antibody

Sign In for Pricing
View Details
Human thymidine phosphorylase (TP) ELISA Kit
GA-E0788HM-01 48 Tests

Human thymidine phosphorylase (TP) ELISA Kit

Sign In for Pricing
View Details