Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Olfactory receptor-like protein I15

This Recombinant Rat Olfactory receptor-like protein I15 spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor-like protein I15

UniProt

P23274

Expression Region

1-314

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEENQTVISQFLLLFLPIPSEHQHVFYALFLSMYLTTVLGNLIIIILIHLDSHLHTPMY LFLSNLSFSDLCFSSVTMPKLLQNMQSQVPSIPFAGCLTQLYFYLYFADLESFLLVAMAY DRYVAICFPLHYMSIMSPKLCVSLVVLSWVLTTFHAMLHTLLMARLSFCADNMIPHFFCD ISPLLKLSCSDTHVNELVIFVMGGLVIVIPFVLIIVSYARVVASILKVPSVRGIHKIFST CGSHLSVVSLFYGTIIGLYLCPSANNSTVKETVMAMMYTVVTPMLNPFIYSLRNRDMKEA LIRVLCKKKITFCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NLG1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-6721R-BF350-01 20 µL

NLG1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
NLG1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-6721R-BF350-02 100 µL

NLG1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
ZSCAN1 Rabbit pAb, AP conjugated
orb2854435 100 µL

ZSCAN1 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
JDP2 Polyclonal Antibody, PE-Cy5 Conjugated
bs-17200R-PE-Cy5 100 µL

JDP2 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Diamine Oxidase Copper-Containing (AOC1) Antibody
abx101154-01 100 µL

Diamine Oxidase Copper-Containing (AOC1) Antibody

Sign In for Pricing
View Details
Diamine Oxidase Copper-Containing (AOC1) Antibody
abx101154-02 200 µL

Diamine Oxidase Copper-Containing (AOC1) Antibody

Sign In for Pricing
View Details