Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 144 (Olfr144)

This Recombinant Mouse Olfactory receptor 144 (Olfr144) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 144, Odorant receptor K4, Olfactory receptor 7B

UniProt

P34983

Expression Region

1-314

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEDMAAGNHCTVTEFFLAGLSEKPELQLPLFLLFTGIYLITMAGNLGMITLIGLSSHLHT PMYYFLSSLSFIDFCQSTVVIPKMLVSFLTEMNIISYSECMAQLYFFLTFGIAECYTLAA MAYDRYVAICNPLLYNVTMSYQIYSSLISGVYIFAVICSSFNTGFMLRTQFCNLDVINHY FCDLLPLLNLASSNTYINEILILFFATLNSFVPVLTIITSYIFIIVTILSIHSREGKFKA FSTCSTHISAVAIFYGSGAFTYLQPSSLNSMGQAKVSSVFYTTVVPMLNPLIYSLRNKDV SIALKKILERKKFM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CUL7 Polyclonal Antibody
HD226014-01 50 µg

Anti-Human CUL7 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human CUL7 Polyclonal Antibody
HD226014-02 100 µg

Anti-Human CUL7 Polyclonal Antibody

Sign In for Pricing
View Details
{4-[ (4-Methylpiperidin-1-yl) methyl]phenyl}methanamine
YLB23340-01 250 mg

{4-[ (4-Methylpiperidin-1-yl) methyl]phenyl}methanamine

Sign In for Pricing
View Details
{4-[ (4-Methylpiperidin-1-yl) methyl]phenyl}methanamine
YLB23340-02 2.5 g

{4-[ (4-Methylpiperidin-1-yl) methyl]phenyl}methanamine

Sign In for Pricing
View Details
WDR13 (NM_001166426) Human Tagged ORF Clone Lentiviral Particle
RC229987L3V 200 µL

WDR13 (NM_001166426) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Cat G Antigen Family D Member 4 (XAGE3) ELISA Kit
MBS9905484 Inquire

Cat G Antigen Family D Member 4 (XAGE3) ELISA Kit

Sign In for Pricing
View Details