Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 144 (Olfr144)

This Recombinant Mouse Olfactory receptor 144 (Olfr144) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 144, Odorant receptor K4, Olfactory receptor 7B

UniProt

P34983

Expression Region

1-314

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEDMAAGNHCTVTEFFLAGLSEKPELQLPLFLLFTGIYLITMAGNLGMITLIGLSSHLHT PMYYFLSSLSFIDFCQSTVVIPKMLVSFLTEMNIISYSECMAQLYFFLTFGIAECYTLAA MAYDRYVAICNPLLYNVTMSYQIYSSLISGVYIFAVICSSFNTGFMLRTQFCNLDVINHY FCDLLPLLNLASSNTYINEILILFFATLNSFVPVLTIITSYIFIIVTILSIHSREGKFKA FSTCSTHISAVAIFYGSGAFTYLQPSSLNSMGQAKVSSVFYTTVVPMLNPLIYSLRNKDV SIALKKILERKKFM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRX1 Rabbit Polyclonal Antibody
TA372800 100 µL

IRX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CDC34 (Cell Division Cycle 34 Homolog (S. cerevisiae), E2-CDC34, UBC3, UBE2R1) (MaxLight 405) discontinued
244459-ML405 100 µL

CDC34 (Cell Division Cycle 34 Homolog (S. cerevisiae), E2-CDC34, UBC3, UBE2R1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Plasmodium Falciparum MSA2 Protein (aa 21-248)
VAng-Wyb6585-50gBaculovirus 50 µg (Baculovirus)

Recombinant Plasmodium Falciparum MSA2 Protein (aa 21-248)

Sign In for Pricing
View Details
Rabbit Polyclonal Jak2 Antibody [DyLight 405]
NBP2-41310V 0.1 mL

Rabbit Polyclonal Jak2 Antibody [DyLight 405]

Sign In for Pricing
View Details
ASPP1 (LX011) Alexa Fluor® 790
sc-53903 AF790 200 µg/mL

ASPP1 (LX011) Alexa Fluor® 790

Sign In for Pricing
View Details
Lipoprotein lipase Polyclonal Antibody, PerCP Conjugated
bs-1973R-PerCP 100 µL

Lipoprotein lipase Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details