Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Olfactory receptor-like protein I9

This Recombinant Rat Olfactory receptor-like protein I9 spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor-like protein I9

UniProt

P23272

Expression Region

1-314

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTRRNQTAISQFFLLGLPFPPEYQHLFYALFLAMYLTTLLGNLIIIILILLDSHLHTPMY LFLSNLSFADLCFSSVTMPKLLQNMQSQVPSIPYAGCLAQIYFFLFFGDLGNFLLVAMAY DRYVAICFPLHYMSIMSPKLCVSLVVLSWVLTTFHAMLHTLLMARLSFCEDSVIPHYFCD MSTLLKVACSDTHDNELAIFILGGPIVVLPFLLIIVSYARIVSSIFKVPSSQSIHKAFST CGSHLSVVSLFYGTVIGLYLCPSANNSTVKETVMSLMYTMVTPMLNPFIYSLRNRDIKDA LEKIMCKKQIPSFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ticarcillin Supplement
MS 2102 5 Vials

Ticarcillin Supplement

Sign In for Pricing
View Details
GPS1 Rabbit pAb
MBS8546438-01 0.1 mL

GPS1 Rabbit pAb

Sign In for Pricing
View Details
GPS1 Rabbit pAb
MBS8546438-02 0.1 mL (AF405L)

GPS1 Rabbit pAb

Sign In for Pricing
View Details
GPS1 Rabbit pAb
MBS8546438-03 0.1 mL (AF405S)

GPS1 Rabbit pAb

Sign In for Pricing
View Details
GPS1 Rabbit pAb
MBS8546438-04 0.1 mL (AF610)

GPS1 Rabbit pAb

Sign In for Pricing
View Details
GPS1 Rabbit pAb
MBS8546438-05 0.1 mL (AF635)

GPS1 Rabbit pAb

Sign In for Pricing
View Details