Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Olfactory receptor-like protein I9

This Recombinant Rat Olfactory receptor-like protein I9 spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor-like protein I9

UniProt

P23272

Expression Region

1-314

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTRRNQTAISQFFLLGLPFPPEYQHLFYALFLAMYLTTLLGNLIIIILILLDSHLHTPMY LFLSNLSFADLCFSSVTMPKLLQNMQSQVPSIPYAGCLAQIYFFLFFGDLGNFLLVAMAY DRYVAICFPLHYMSIMSPKLCVSLVVLSWVLTTFHAMLHTLLMARLSFCEDSVIPHYFCD MSTLLKVACSDTHDNELAIFILGGPIVVLPFLLIIVSYARIVSSIFKVPSSQSIHKAFST CGSHLSVVSLFYGTVIGLYLCPSANNSTVKETVMSLMYTMVTPMLNPFIYSLRNRDIKDA LEKIMCKKQIPSFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAS2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-9672R-BF555 100 µL

LAS2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Recombinant Mycobacterium paratuberculosis FO synthase (fbiC), partial
MBS1370470 Inquire

Recombinant Mycobacterium paratuberculosis FO synthase (fbiC), partial

Sign In for Pricing
View Details
Brd9 (NM_001107453) Rat Tagged Lenti ORF Clone
RR215693L3 10 µg

Brd9 (NM_001107453) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Neisseria gonorrhoeae
MBS324196-01 1 mL

Neisseria gonorrhoeae

Sign In for Pricing
View Details
Neisseria gonorrhoeae
MBS324196-02 5x 1 mL

Neisseria gonorrhoeae

Sign In for Pricing
View Details
MT1M (Metallothionein 1M) BioAssayTM ELISA Kit (Human) discontinued
383750 96 Tests

MT1M (Metallothionein 1M) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details