Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Olfactory receptor-like protein I9

This Recombinant Rat Olfactory receptor-like protein I9 spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor-like protein I9

UniProt

P23272

Expression Region

1-314

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTRRNQTAISQFFLLGLPFPPEYQHLFYALFLAMYLTTLLGNLIIIILILLDSHLHTPMY LFLSNLSFADLCFSSVTMPKLLQNMQSQVPSIPYAGCLAQIYFFLFFGDLGNFLLVAMAY DRYVAICFPLHYMSIMSPKLCVSLVVLSWVLTTFHAMLHTLLMARLSFCEDSVIPHYFCD MSTLLKVACSDTHDNELAIFILGGPIVVLPFLLIIVSYARIVSSIFKVPSSQSIHKAFST CGSHLSVVSLFYGTVIGLYLCPSANNSTVKETVMSLMYTMVTPMLNPFIYSLRNRDIKDA LEKIMCKKQIPSFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant DNAM-1 Protein (Glu 19-Asn 247) [His]
VAng-1465Lsx-1mg 1 mg

Recombinant DNAM-1 Protein (Glu 19-Asn 247) [His]

Sign In for Pricing
View Details
CKMM (Creatine Kinase M-type, Creatine Kinase M Chain, M-CK, CKM, CK-MM) (HRP)
C7910-28K-HRP 100 µL

CKMM (Creatine Kinase M-type, Creatine Kinase M Chain, M-CK, CKM, CK-MM) (HRP)

Sign In for Pricing
View Details
Recombinant Pyrobaculum islandicum Chorismate synthase (aroC)
MBS1061073-01 0.02 mg (E-Coli)

Recombinant Pyrobaculum islandicum Chorismate synthase (aroC)

Sign In for Pricing
View Details
Recombinant Pyrobaculum islandicum Chorismate synthase (aroC)
MBS1061073-02 0.02 mg (Yeast)

Recombinant Pyrobaculum islandicum Chorismate synthase (aroC)

Sign In for Pricing
View Details
Recombinant Pyrobaculum islandicum Chorismate synthase (aroC)
MBS1061073-03 0.1 mg (E-Coli)

Recombinant Pyrobaculum islandicum Chorismate synthase (aroC)

Sign In for Pricing
View Details
Recombinant Pyrobaculum islandicum Chorismate synthase (aroC)
MBS1061073-04 0.1 mg (Yeast)

Recombinant Pyrobaculum islandicum Chorismate synthase (aroC)

Sign In for Pricing
View Details