Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome c biogenesis protein CcsA (ccsA)

This Recombinant Prochlorococcus marinus Cytochrome c biogenesis protein CcsA (ccsA) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein CcsA

UniProt

A2C1K1

Expression Region

1-315

Origin

Prochlorococcus marinus (strain NATL1A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVDFQLNNFSFDPVVSLGLAAFLFLLIALPISFWSVAGGSDSSKARFLVATSNLFLTSQL ILRWWQSGHFPISNLYESLCFLTWGCTLAQLFVERAWRSPIVSAVATPVSLLSIGFASFV LPENLQSSAPLVPALRSSWLVMHVSVIMCSYAALLIGSILSFGVFLVDGKKQFNIRNSSF GSGSFRQSSELYLDERNENLNSIQPIEFTNAEQLDSLSYRSITAGFLLLTVGLISGAVWA NEAWGSWWSWDPKETWALICWLVYAAYLHTRLTRGWQGKKPAILAIAGFFVIIVCYIGVN LLGVGLHSYGWFFDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepatitis B Surface Antigen (HBsAg) (APC)
MBS6260681-01 0.1 mL

Hepatitis B Surface Antigen (HBsAg) (APC)

Sign In for Pricing
View Details
Hepatitis B Surface Antigen (HBsAg) (APC)
MBS6260681-02 5x 0.1 mL

Hepatitis B Surface Antigen (HBsAg) (APC)

Sign In for Pricing
View Details
FPRL1 Polyclonal Antibody, PerCP Conjugated
bs-3654R-PerCP 100 µL

FPRL1 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Zdhhc9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3697608 1.0 µg DNA

Zdhhc9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
CCND1 Rabbit Polyclonal Antibody
orb573590 100 µL

CCND1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF12 (NM_006956) Human Over-expression Lysate
LY416304 100 µg

ZNF12 (NM_006956) Human Over-expression Lysate

Sign In for Pricing
View Details