Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome c biogenesis protein CcsA (ccsA)

This Recombinant Prochlorococcus marinus Cytochrome c biogenesis protein CcsA (ccsA) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein CcsA

UniProt

A2C1K1

Expression Region

1-315

Origin

Prochlorococcus marinus (strain NATL1A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVDFQLNNFSFDPVVSLGLAAFLFLLIALPISFWSVAGGSDSSKARFLVATSNLFLTSQL ILRWWQSGHFPISNLYESLCFLTWGCTLAQLFVERAWRSPIVSAVATPVSLLSIGFASFV LPENLQSSAPLVPALRSSWLVMHVSVIMCSYAALLIGSILSFGVFLVDGKKQFNIRNSSF GSGSFRQSSELYLDERNENLNSIQPIEFTNAEQLDSLSYRSITAGFLLLTVGLISGAVWA NEAWGSWWSWDPKETWALICWLVYAAYLHTRLTRGWQGKKPAILAIAGFFVIIVCYIGVN LLGVGLHSYGWFFDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Alpha-synuclein/Snca Protein, No Tag
MOP2069-01 100 µg

Recombinant Mouse Alpha-synuclein/Snca Protein, No Tag

Sign In for Pricing
View Details
Recombinant Mouse Alpha-synuclein/Snca Protein, No Tag
MOP2069-02 50 µg

Recombinant Mouse Alpha-synuclein/Snca Protein, No Tag

Sign In for Pricing
View Details
Buspirone HCl
C10059-1g 1 g

Buspirone HCl

Sign In for Pricing
View Details
Mouse Gcc2 Pre-designed siRNA Set A
SI105324A 1 Each

Mouse Gcc2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Dsp AAV siRNA Pooled Vector
18632164 1.0 µg

Dsp AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Tnxb (NM_031176) Mouse Untagged Clone
MC229766 10 µg

Tnxb (NM_031176) Mouse Untagged Clone

Sign In for Pricing
View Details