Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome c biogenesis protein CcsA (ccsA)

This Recombinant Prochlorococcus marinus Cytochrome c biogenesis protein CcsA (ccsA) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein CcsA

UniProt

A2C1K1

Expression Region

1-315

Origin

Prochlorococcus marinus (strain NATL1A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVDFQLNNFSFDPVVSLGLAAFLFLLIALPISFWSVAGGSDSSKARFLVATSNLFLTSQL ILRWWQSGHFPISNLYESLCFLTWGCTLAQLFVERAWRSPIVSAVATPVSLLSIGFASFV LPENLQSSAPLVPALRSSWLVMHVSVIMCSYAALLIGSILSFGVFLVDGKKQFNIRNSSF GSGSFRQSSELYLDERNENLNSIQPIEFTNAEQLDSLSYRSITAGFLLLTVGLISGAVWA NEAWGSWWSWDPKETWALICWLVYAAYLHTRLTRGWQGKKPAILAIAGFFVIIVCYIGVN LLGVGLHSYGWFFDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PTBP1 Protein - (Dry Ice)
H00005725-P02-10ug 10 µg

Recombinant Human PTBP1 Protein - (Dry Ice)

Sign In for Pricing
View Details
RPS2P35-set siRNA/shRNA/RNAi Lentivector (Human)
42468091 4x 500 ng

RPS2P35-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Horse anti-toxoplasmosis antibody IgG, TOXO Ab IgG ELISA Kit
MBS1610069-01 96 Strip Well

Horse anti-toxoplasmosis antibody IgG, TOXO Ab IgG ELISA Kit

Sign In for Pricing
View Details
Horse anti-toxoplasmosis antibody IgG, TOXO Ab IgG ELISA Kit
MBS1610069-02 5x 96 Strip Well

Horse anti-toxoplasmosis antibody IgG, TOXO Ab IgG ELISA Kit

Sign In for Pricing
View Details
Horse anti-toxoplasmosis antibody IgG, TOXO Ab IgG ELISA Kit
MBS1610069-03 10x 96 Strip Well

Horse anti-toxoplasmosis antibody IgG, TOXO Ab IgG ELISA Kit

Sign In for Pricing
View Details
Fruit fly mei-217/217 Rabbit Polyclonal Antibody (FITC)
orb2571817 200 µL

Fruit fly mei-217/217 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details