Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus Taste receptor type 2 member 3 (TAS2R3)

This Recombinant Pongo pygmaeus Taste receptor type 2 member 3 (TAS2R3) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 3, T2R3

UniProt

Q645U2

Expression Region

1-315

Origin

Pongo pygmaeus (Bornean orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLTEGLFLILSGTQFALGILVNCFIGLVNGSSWFKTKRMSLSDFIITTLAFLRIILLCI ILTDSFLIEFSPNAHDSGVIMQIIDVSWTFTNHLSIWLATCLGVLYCLKIASFSHPTFLW LKWRVSRVMVWMLLGVLLLSCGSTASLINEFKLYSVFRGIEATXNVTEHFRKKRSEYYLI HVLGTLWYLPPLIVSLAAYFLLIFSLGRHTRQMLQNGTSSRDPSTEAHKRAIRIILSSFF LFLLYFLAFLIASFGNFLPKTKMAKMIGEVMTMFYPAGHSFILILGNSKLKQTFVEMLRC ESGHLKPGSKGPIFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant IKK alpha Antibody
RC-16758-01 50 μL

Recombinant IKK alpha Antibody

Sign In for Pricing
View Details
Recombinant IKK alpha Antibody
RC-16758-02 100 µL

Recombinant IKK alpha Antibody

Sign In for Pricing
View Details
Recombinant IKK alpha Antibody
RC-16758-03 1 mL

Recombinant IKK alpha Antibody

Sign In for Pricing
View Details
RSPO1 (NM_001038633) Human Over-expression Lysate
LY422005 100 µg

RSPO1 (NM_001038633) Human Over-expression Lysate

Sign In for Pricing
View Details
Pan-Lactyl-lysine Recombinant Rabbit monoclonal Antibody
HA750907 100 µL

Pan-Lactyl-lysine Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike Protein (RBD, His Tag) (W436R)
PKSV030469 100 µg

Recombinant SARS-CoV-2 Spike Protein (RBD, His Tag) (W436R)

Sign In for Pricing
View Details