Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus Taste receptor type 2 member 3 (TAS2R3)

This Recombinant Pongo pygmaeus Taste receptor type 2 member 3 (TAS2R3) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 3, T2R3

UniProt

Q645U2

Expression Region

1-315

Origin

Pongo pygmaeus (Bornean orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLTEGLFLILSGTQFALGILVNCFIGLVNGSSWFKTKRMSLSDFIITTLAFLRIILLCI ILTDSFLIEFSPNAHDSGVIMQIIDVSWTFTNHLSIWLATCLGVLYCLKIASFSHPTFLW LKWRVSRVMVWMLLGVLLLSCGSTASLINEFKLYSVFRGIEATXNVTEHFRKKRSEYYLI HVLGTLWYLPPLIVSLAAYFLLIFSLGRHTRQMLQNGTSSRDPSTEAHKRAIRIILSSFF LFLLYFLAFLIASFGNFLPKTKMAKMIGEVMTMFYPAGHSFILILGNSKLKQTFVEMLRC ESGHLKPGSKGPIFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FKBP11 (NM_016594) Human Recombinant Protein
TP306481L 1 mg

FKBP11 (NM_016594) Human Recombinant Protein

Sign In for Pricing
View Details
Human MARS2 activation kit by CRISPRa
GA114251 1 Kit

Human MARS2 activation kit by CRISPRa

Sign In for Pricing
View Details
PI 3 Kinase catalytic subunit gamma (PIK3CG) (NM_002649) Human Recombinant Protein
TP307790L 1 mg

PI 3 Kinase catalytic subunit gamma (PIK3CG) (NM_002649) Human Recombinant Protein

Sign In for Pricing
View Details
CAmLG (NM_001745) Human Recombinant Protein
TP318292M 100 µg

CAmLG (NM_001745) Human Recombinant Protein

Sign In for Pricing
View Details
Palladin Antibody
KC-1188-01 50 μL

Palladin Antibody

Sign In for Pricing
View Details
Palladin Antibody
KC-1188-02 100 µL

Palladin Antibody

Sign In for Pricing
View Details