Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 139 (Olfr139)

This Recombinant Mouse Olfactory receptor 139 (Olfr139) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 139, Odorant receptor M5, Olfactory receptor 1, Olfactory receptor 255-2

UniProt

Q60891

Expression Region

1-315

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPGAWGNRTAVTDFILLGLTGNVRLQPILFVVFFFAYIVTVGGNLSILAAIFVEPKLHT PMYYFLGNLSLLDIGCISVTVPPMLVCLLAHECRVPYAACISQLFFFHLLAGVDCHLLTA MAYDRYLAICQPLTYSTRMSREVQGTLVGICCTVSFINALTHTVAVSVLDFCGPNVVNHF YCDLPPLFQLSCSSIYLNGQLLFVGATFMGVVPMILISVSYAHVAAAVLRIRSTEGRKKA FSTCGSHLTVVCIFYGTGFFSYMRLGSVSASDKDKGIGILNTILSPMLNPLIYSLRNPDV QGALKRVLTGKRYPV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Non-sterile Hydrophobic PTFE Syringe Filters, 0.45 (μm), 25 (mm), PP Prefilter, 100pcs/pk
11028511 100 PCS

Non-sterile Hydrophobic PTFE Syringe Filters, 0.45 (μm), 25 (mm), PP Prefilter, 100pcs/pk

Sign In for Pricing
View Details
CC50B, NT (TMEM30B, CDC50B, Cell cycle control protein 50B, Transmembrane protein 30B) (Biotin) discontinued
033266-Biotin 200 µL

CC50B, NT (TMEM30B, CDC50B, Cell cycle control protein 50B, Transmembrane protein 30B) (Biotin) discontinued

Sign In for Pricing
View Details
Rgr (NM_001301694) Mouse Untagged Clone
MC226132 10 µg

Rgr (NM_001301694) Mouse Untagged Clone

Sign In for Pricing
View Details
Human Acid Phosphatase 6, Lysophosphatidic (ACP6) Protein
abx650289-01 10 µg

Human Acid Phosphatase 6, Lysophosphatidic (ACP6) Protein

Sign In for Pricing
View Details
Human Acid Phosphatase 6, Lysophosphatidic (ACP6) Protein
abx650289-02 50 µg

Human Acid Phosphatase 6, Lysophosphatidic (ACP6) Protein

Sign In for Pricing
View Details
Human Acid Phosphatase 6, Lysophosphatidic (ACP6) Protein
abx650289-03 100 µg

Human Acid Phosphatase 6, Lysophosphatidic (ACP6) Protein

Sign In for Pricing
View Details