Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2T5 (OR2T5)

This Recombinant Human Olfactory receptor 2T5 (OR2T5) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 2T5, Olfactory receptor OR1-62

UniProt

Q6IEZ7

Expression Region

1-315

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANITRMANHTGKLDFILMGLFRRSKHPALLSVVIFVVFLKALSGNAVLILLIHCDAHLH SPMYFFISQLSLMDMAYISVTVPKMLLDQVMGVNKVSAPECGMQMFLYLTLAGSEFFLLA TMAYDRYVAICHPLRYPVLMNHRVCLFLASGCWFLGSVDGFMLTPITMSFPFCRSWEIHH FFCEVPAVTILSCSDTSLYETLMYLCCVLMLLIPVTIISSSYLLILLTVHRMNSAEGRKK AFATCSSHLTVVILFYGAAVYTYMLPSSYHTPEKDMMVSVFYTILTPVLNPLIYSLRNKD VMGALKKMLTVRFVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM79 siRNA (Rat)
MBS8226777-01 15 nmol

TMEM79 siRNA (Rat)

Sign In for Pricing
View Details
TMEM79 siRNA (Rat)
MBS8226777-02 30 nmol

TMEM79 siRNA (Rat)

Sign In for Pricing
View Details
TMEM79 siRNA (Rat)
MBS8226777-03 5x 30 nmol

TMEM79 siRNA (Rat)

Sign In for Pricing
View Details
Mouse Monoclonal gamma Catenin Antibody (rCTNG/1664) [Alexa Fluor 488]
NBP3-08469AF488 100 µL

Mouse Monoclonal gamma Catenin Antibody (rCTNG/1664) [Alexa Fluor 488]

Sign In for Pricing
View Details
Human Putative protein RFPL3S, RFPL3-AS1 ELISA KIT
ELI-18032h 96 Tests

Human Putative protein RFPL3S, RFPL3-AS1 ELISA KIT

Sign In for Pricing
View Details
E2A (Phospho-Thr355) Antibody
8A8339-AAT 50 µg

E2A (Phospho-Thr355) Antibody

Sign In for Pricing
View Details