Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2T5 (OR2T5)

This Recombinant Human Olfactory receptor 2T5 (OR2T5) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 2T5, Olfactory receptor OR1-62

UniProt

Q6IEZ7

Expression Region

1-315

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANITRMANHTGKLDFILMGLFRRSKHPALLSVVIFVVFLKALSGNAVLILLIHCDAHLH SPMYFFISQLSLMDMAYISVTVPKMLLDQVMGVNKVSAPECGMQMFLYLTLAGSEFFLLA TMAYDRYVAICHPLRYPVLMNHRVCLFLASGCWFLGSVDGFMLTPITMSFPFCRSWEIHH FFCEVPAVTILSCSDTSLYETLMYLCCVLMLLIPVTIISSSYLLILLTVHRMNSAEGRKK AFATCSSHLTVVILFYGAAVYTYMLPSSYHTPEKDMMVSVFYTILTPVLNPLIYSLRNKD VMGALKKMLTVRFVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6030446N20Rik (BC094382) Mouse Tagged Lenti ORF Clone
MR203822L4 10 µg

6030446N20Rik (BC094382) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
L-Tyrosine 99% For Biochemistry
280300500 500 mg

L-Tyrosine 99% For Biochemistry

Sign In for Pricing
View Details
Recombinant Aeromonas Salmonicida cvrA Protein
VAng-Lsx1504-1mgEcoli 1 mg (E. coli)

Recombinant Aeromonas Salmonicida cvrA Protein

Sign In for Pricing
View Details
PCDH1 (NM_001278613) Human Tagged ORF Clone
RG239942 10 µg

PCDH1 (NM_001278613) Human Tagged ORF Clone

Sign In for Pricing
View Details
METTL23 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV767402 1.0 µg DNA

METTL23 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
EIF4EBP1, phosphorylated (Thr36) (Eukaryotic Translation Initiation Factor 4E-binding Protein 1, 4E-BP1, eIF4E-binding Protein 1, Phosphorylated Heat- and Acid-stable Protein Regulated by Insulin 1, PHAS-I) discontinued
0004-21K 50 µg

EIF4EBP1, phosphorylated (Thr36) (Eukaryotic Translation Initiation Factor 4E-binding Protein 1, 4E-BP1, eIF4E-binding Protein 1, Phosphorylated Heat- and Acid-stable Protein Regulated by Insulin 1, PHAS-I) discontinued

Sign In for Pricing
View Details