Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5M10 (OR5M10)

This Recombinant Human Olfactory receptor 5M10 (OR5M10) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 5M10, Olfactory receptor OR11-207

UniProt

Q6IEU7

Expression Region

1-315

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSPNHTIVTEFILLGLTDDPVLEKILFGVFLAIYLITLAGNLCMILLIRTNSQLQTPMY FFLGHLSFVDICYSSNVTPNMLHNFLSEQKTISYAGCFTQCLLFIALVITEFYFLASMAL DRYVAICSPLHYSSRMSKNICISLVTVPYMYGFLNGLSQTLLTFHLSFCGSLEINHFYCA DPPLIMLACSDTRVKKMAMFVVAGFTLSSSLFIILLSYLFIFAAIFRIRSAEGRHKAFST CASHLTIVTLFYGTLFCMYVRPPSEKSVEESKIIAVFYTFLSPMLNPLIYSLRNRDVILA IQQMIRGKSFCKIAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Dermal Hair Papilla (Primary cell immortalization) Cell Complete Medium
CM-H249Y-01 100 mL

Human Dermal Hair Papilla (Primary cell immortalization) Cell Complete Medium

Sign In for Pricing
View Details
Human Dermal Hair Papilla (Primary cell immortalization) Cell Complete Medium
CM-H249Y-02 4x 125 mL

Human Dermal Hair Papilla (Primary cell immortalization) Cell Complete Medium

Sign In for Pricing
View Details
LentimiRa-rno-miR-672-3p Vector
mr40921 500 ng

LentimiRa-rno-miR-672-3p Vector

Sign In for Pricing
View Details
P2RY12 polyclonal antibody
orb648828-01 50 μL

P2RY12 polyclonal antibody

Sign In for Pricing
View Details
P2RY12 polyclonal antibody
orb648828-02 100 µL

P2RY12 polyclonal antibody

Sign In for Pricing
View Details
P2RY12 polyclonal antibody
orb648828-03 200 µL

P2RY12 polyclonal antibody

Sign In for Pricing
View Details