Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4K3 (OR4K3)

This Recombinant Human Olfactory receptor 4K3 (OR4K3) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 4K3, Olfactory receptor OR14-14

UniProt

Q96R72

Expression Region

1-315

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAWSNQSAVTEFILRGLSSSLELQIFYFLFFSIVYAATVLGNLLIVVTIASEPHLHSPMY FLLGNLSFIDMSLASFATPKMIADFLREHKAISFEGCMTQMFFLHLLGGAEIVLLISMSF DRYVAICKPLHYLTIMSRRMCVGLVILSWIVGIFHALSQLAFTVNLPFCGPNEVDSFFCD LPLVIKLACVDTYILGVFMISTSGMIALVCFILLVISYTIILVTVRQRSSGGSSKALSTC SAHFTVVTLFFGPCTFIYVWPFTNFPIDKVLSVFYTIYTPLLNPVIYTVRNKDVKYSMRK LSSHIFKSRKTDHTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human NANS Protein
NBP1-50870-0.5mg 0.5 mg

Recombinant Human NANS Protein

Sign In for Pricing
View Details
Tmem167b Rat shRNA Lentiviral Particle (Locus ID 499690)
TL708948V 500 µL Each

Tmem167b Rat shRNA Lentiviral Particle (Locus ID 499690)

Sign In for Pricing
View Details
C-Reactive Protein (CRP) Deficient Human Plasma Lyophilized
MBS136392-01 1 mL

C-Reactive Protein (CRP) Deficient Human Plasma Lyophilized

Sign In for Pricing
View Details
C-Reactive Protein (CRP) Deficient Human Plasma Lyophilized
MBS136392-02 10 mL

C-Reactive Protein (CRP) Deficient Human Plasma Lyophilized

Sign In for Pricing
View Details
C-Reactive Protein (CRP) Deficient Human Plasma Lyophilized
MBS136392-03 5x 10 mL

C-Reactive Protein (CRP) Deficient Human Plasma Lyophilized

Sign In for Pricing
View Details
Olr1132 Rat shRNA Plasmid (Locus ID 405344)
TR700356 1 Kit

Olr1132 Rat shRNA Plasmid (Locus ID 405344)

Sign In for Pricing
View Details