Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5M1 (OR5M1)

This Recombinant Human Olfactory receptor 5M1 (OR5M1) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 5M1, OST050, Olfactory receptor OR11-208

UniProt

Q8NGP8

Expression Region

1-315

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSPNHTIVTEFILLGLTDDPVLEKILFGVFLAIYLITLAGNLCMILLIRTNSHLQTPMY FFLGHLSFVDICYSSNVTPNMLHNFLSEQKTISYAGCFTQCLLFIALVITEFYILASMAL DRYVAICSPLHYSSRMSKNICVCLVTIPYMYGFLSGFSQSLLTFHLSFCGSLEINHFYCA DPPLIMLACSDTRVKKMAMFVVAGFNLSSSLFIILLSYLFIFAAIFRIRSAEGRHKAFST CASHLTIVTLFYGTLFCMYVRPPSEKSVEESKITAVFYTFLSPMLNPLIYSLRNTDVILA MQQMIRGKSFHKIAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEPTOR Polyclonal Antibody, PE-Cy5 Conjugated
bs-23313R-PE-Cy5 100 µL

DEPTOR Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Hsa-miR-95-5p miRNA Mimic
CMH2036-01 5 nmol

Hsa-miR-95-5p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-95-5p miRNA Mimic
CMH2036-02 10 nmol

Hsa-miR-95-5p miRNA Mimic

Sign In for Pricing
View Details
Mouse Or5p60 qPCR Primer Pair
QM65994S 200 Tests

Mouse Or5p60 qPCR Primer Pair

Sign In for Pricing
View Details
Phospho-MKK3 (Ser 189) /MKK6 (Ser 207) Rabbit mAb
F0704-100uL 100 µL

Phospho-MKK3 (Ser 189) /MKK6 (Ser 207) Rabbit mAb

Sign In for Pricing
View Details
Trimethylacetic anhydride
M12174-01 50 mg

Trimethylacetic anhydride

Sign In for Pricing
View Details