Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5M1 (OR5M1)

This Recombinant Human Olfactory receptor 5M1 (OR5M1) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 5M1, OST050, Olfactory receptor OR11-208

UniProt

Q8NGP8

Expression Region

1-315

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSPNHTIVTEFILLGLTDDPVLEKILFGVFLAIYLITLAGNLCMILLIRTNSHLQTPMY FFLGHLSFVDICYSSNVTPNMLHNFLSEQKTISYAGCFTQCLLFIALVITEFYILASMAL DRYVAICSPLHYSSRMSKNICVCLVTIPYMYGFLSGFSQSLLTFHLSFCGSLEINHFYCA DPPLIMLACSDTRVKKMAMFVVAGFNLSSSLFIILLSYLFIFAAIFRIRSAEGRHKAFST CASHLTIVTLFYGTLFCMYVRPPSEKSVEESKITAVFYTFLSPMLNPLIYSLRNTDVILA MQQMIRGKSFHKIAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM143 Antibody
A36789-50UG 50 µg

TMEM143 Antibody

Sign In for Pricing
View Details
Chemokine Like Factor Superfamily 8 (CKLFSF8) BioAssayTM ECL ELISA Kit (Mouse) discontinued
157484-01 48 Tests

Chemokine Like Factor Superfamily 8 (CKLFSF8) BioAssayTM ECL ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
Chemokine Like Factor Superfamily 8 (CKLFSF8) BioAssayTM ECL ELISA Kit (Mouse) discontinued
157484-02 96 Tests

Chemokine Like Factor Superfamily 8 (CKLFSF8) BioAssayTM ECL ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
Closure, Screw-Thread, Phenolic, Cone-Shaped
1220368 144 PK

Closure, Screw-Thread, Phenolic, Cone-Shaped

Sign In for Pricing
View Details
TSPAN9 Protein Vector (Rat) (pPB-N-His)
PV313387 500 ng

TSPAN9 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
NSUN5B sgRNA CRISPR Lentivector (Human) (Target 2)
K1458403 1.0 µg DNA

NSUN5B sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details