Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2T29 (OR2T29)

This Recombinant Human Olfactory receptor 2T29 (OR2T29) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 2T29

UniProt

Q8NH02

Expression Region

1-315

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANITRMANHTGRLDFILMGLFRQSKHPALLSVVIFVVFLKALSGNAVLILLIHCDAHLH SPMYFFISQLSLMDMAYISVTVPKMLLDQVMGVNKVSAPECGMQMFLYLTLAGSEFFLLA TMAYDRYVAICHPLRYPVLMNHRVCLFLASGCWFLGSVDGFMLTPITMSFPFCRSWEIHH FFCEVPAVTILSCSDTSLYETLMYLCCVLMLLIPVTIISSSYLLILLTVHRMNSAEGRKK AFATCSSHLTVVILFYGAAVYTYMLPSSYHTPEKDMMVSVFYTILTPVLNPLIYSLRNKD VMGALKKMLTVRFVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CHTF18 siRNA
abx911836-01 15 nmol

Mouse CHTF18 siRNA

Sign In for Pricing
View Details
Mouse CHTF18 siRNA
abx911836-02 30 nmol

Mouse CHTF18 siRNA

Sign In for Pricing
View Details
BIK sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
13322111 3x 1.0 µg

BIK sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
PCMV-ETS2-3xFLAG-Neo Plasmid
PVT64247 2 µg

PCMV-ETS2-3xFLAG-Neo Plasmid

Sign In for Pricing
View Details
(Naphthalen-1-yl) (thiophen-2-yl) methanone
GCA66233-01 100 mg

(Naphthalen-1-yl) (thiophen-2-yl) methanone

Sign In for Pricing
View Details
(Naphthalen-1-yl) (thiophen-2-yl) methanone
GCA66233-02 1 g

(Naphthalen-1-yl) (thiophen-2-yl) methanone

Sign In for Pricing
View Details