Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 56A3 (OR56A3)

This Recombinant Human Olfactory receptor 56A3 (OR56A3) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 56A3, Olfactory receptor 56A6

UniProt

Q8NH54

Expression Region

1-315

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTHRNDTLSTEASDFLLNCFVRSPSWQHWLSLPLSLLFLLAVGANTTLLMTIWLEASLH QPLYYLLSLLSLLDIVLCLTVIPKVLTIFWFDLRPISFPACFLQMYIMNCFLAMESCTFM VMAYDRYVAICHPLRYPSIITDHFVVKAAMFILTRNVLMTLPIPILSAQLRYCGRNVIEN CICANMSVSRLSCDDVTINHLYQFAGGWTLLGSDLILIFLSYTFILRAVLRLKAEGAVAK ALSTCGSHFMLILFFSTILLVFVLTHVAKKKVSPDVPVLLNVLHHVIPAALNPIIYGVRT QEIKQGMQRLLKKGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3280), CF405S conjugate, 0.1mg/mL
BNC043280-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3280), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FUT7 Human Gene Knockout Kit (CRISPR)
KN416316 1 Kit

FUT7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Sambucus nigra (Elderberry Bark) -SNA-I-
LA-6802-1 1 mg

Alkaline Phosphatase Conjugated Sambucus nigra (Elderberry Bark) -SNA-I-

Sign In for Pricing
View Details
Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3241), CF740 conjugate, 0.1mg/mL
BNC743241-500 1x 500 µL

Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3241), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-(4,5-Dihydro-1H-imidazol-2-yl)-2,1,3-benzothiadiazol-4-amine
TRC-D453090-10MG 10 mg

N-(4,5-Dihydro-1H-imidazol-2-yl)-2,1,3-benzothiadiazol-4-amine

Sign In for Pricing
View Details
PRPF39 Human Gene Knockout Kit (CRISPR)
KN422018 1 Kit

PRPF39 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details