Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2V2 (OR2V2)

This Recombinant Human Olfactory receptor 2V2 (OR2V2) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 2V2, Olfactory receptor 2V3, Olfactory receptor OR5-3

UniProt

Q96R30

Expression Region

1-315

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METWVNQSYTDGFFLLGIFSHSTADLVLFSVVMAVFTVALCGNVLLIFLIYMDPHLHTPM YFFLSQLSLMDLMLVCTNVPKMAANFLSGRKSISFVGCGIQIGLFVCLVGSEGLLLGLMA YDRYVAISHPLHYPILMNQRVCLQITGSSWAFGIIDGLIQMVVVMNFPYCGLRKVNHFFC EMLSLLKLACVDTSLFEKVIFACCVFMLLFPFSIIVASYAHILGTVLQMHSAQAWKKALA TCSSHLTAVTLFYGAAMFIYLRPRHYRAPSHDKVASIFYTVLTPMLNPLIYSLRNREVMG ALRKGLDRCRIGSQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGEA2 Rabbit Polyclonal Antibody (Cy3)
orb981606 100 µL

MAGEA2 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Bcl-2 Rabbit pAb
E47R33411 100 µL

Bcl-2 Rabbit pAb

Sign In for Pricing
View Details
SIPA1L1 (NM_015556) Human Over-expression Lysate
LY414471 100 µg

SIPA1L1 (NM_015556) Human Over-expression Lysate

Sign In for Pricing
View Details
COL11A2 AAV siRNA Pooled Vector
16551161 1.0 µg

COL11A2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Cinchonine 98% For Synthesis
00815 00025 25 g

Cinchonine 98% For Synthesis

Sign In for Pricing
View Details
ATXN7L2 Lentiviral Activation Particles (m)
sc-428368-LAC 200 µL

ATXN7L2 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details