Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2V2 (OR2V2)

This Recombinant Human Olfactory receptor 2V2 (OR2V2) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 2V2, Olfactory receptor 2V3, Olfactory receptor OR5-3

UniProt

Q96R30

Expression Region

1-315

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METWVNQSYTDGFFLLGIFSHSTADLVLFSVVMAVFTVALCGNVLLIFLIYMDPHLHTPM YFFLSQLSLMDLMLVCTNVPKMAANFLSGRKSISFVGCGIQIGLFVCLVGSEGLLLGLMA YDRYVAISHPLHYPILMNQRVCLQITGSSWAFGIIDGLIQMVVVMNFPYCGLRKVNHFFC EMLSLLKLACVDTSLFEKVIFACCVFMLLFPFSIIVASYAHILGTVLQMHSAQAWKKALA TCSSHLTAVTLFYGAAMFIYLRPRHYRAPSHDKVASIFYTVLTPMLNPLIYSLRNREVMG ALRKGLDRCRIGSQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- ((3,3-Diphenylpropyl) (methyl) amino) -2-methylpropan-2-yl 3-oxobutanoate
OR1069005-01 50 mg

1- ((3,3-Diphenylpropyl) (methyl) amino) -2-methylpropan-2-yl 3-oxobutanoate

Sign In for Pricing
View Details
1- ((3,3-Diphenylpropyl) (methyl) amino) -2-methylpropan-2-yl 3-oxobutanoate
OR1069005-02 100 mg

1- ((3,3-Diphenylpropyl) (methyl) amino) -2-methylpropan-2-yl 3-oxobutanoate

Sign In for Pricing
View Details
1- ((3,3-Diphenylpropyl) (methyl) amino) -2-methylpropan-2-yl 3-oxobutanoate
OR1069005-03 250 mg

1- ((3,3-Diphenylpropyl) (methyl) amino) -2-methylpropan-2-yl 3-oxobutanoate

Sign In for Pricing
View Details
1- ((3,3-Diphenylpropyl) (methyl) amino) -2-methylpropan-2-yl 3-oxobutanoate
OR1069005-04 1 g

1- ((3,3-Diphenylpropyl) (methyl) amino) -2-methylpropan-2-yl 3-oxobutanoate

Sign In for Pricing
View Details
Recombinant Human Tumor necrosis factor receptor superfamily member 5 (CD40), partial, Active Protein
RPC28064-01 20 µg

Recombinant Human Tumor necrosis factor receptor superfamily member 5 (CD40), partial, Active Protein

Sign In for Pricing
View Details
Recombinant Human Tumor necrosis factor receptor superfamily member 5 (CD40), partial, Active Protein
RPC28064-02 100 µg

Recombinant Human Tumor necrosis factor receptor superfamily member 5 (CD40), partial, Active Protein

Sign In for Pricing
View Details