Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4K17 (OR4K17)

This Recombinant Human Olfactory receptor 4K17 (OR4K17) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 4K17, Olfactory receptor OR14-29

UniProt

Q8NGC6

Expression Region

1-315

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAMKLLNQSQVSEFILLGLTSSQDVEFLLFALFSVIYVVTVLGNLLIIVTVFNTPNLNT PMYFLLGNLSFVDMTLASFATPKVILNLLKKQKVISFAGCFTQIFLLHLLGGVEMVLLVS MAFDRYVAICKPLHYMTIMNKKVCVLLVVTSWLLGLLHSGFQIPFAVNLPFCGPNVVDSI FCDLPLVTKLACIDIYFVQVVIVANSGIISLSCFIILLISYSLILITIKNHSPTGQSKAR STLTAHITVVILFFGPCIFIYIWPFGNHSVDKFLAVFYTIITPILNPIIYTLRNKEMKIS MKKLWRAFVNSREDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HNRNPH2 knockout cell line
ABC-KH6916 1 Vial

Human HNRNPH2 knockout cell line

Sign In for Pricing
View Details
1- (3-fluorophenyl) -1H-tetrazole-5-thiol
sc-272953 250 mg

1- (3-fluorophenyl) -1H-tetrazole-5-thiol

Sign In for Pricing
View Details
G4 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV659328 1.0 µg DNA

G4 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
IRAK2 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-1427R-BF750 100 µL

IRAK2 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Asialoglycoprotein Receptor 2 (ASGR2) (NM_001181) Human Over-expression Lysate
LS000433 100 µg

Asialoglycoprotein Receptor 2 (ASGR2) (NM_001181) Human Over-expression Lysate

Sign In for Pricing
View Details
IL-22 Rabbit Polyclonal Antibody
APRab00642-01 20 µL

IL-22 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details