Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4K17 (OR4K17)

This Recombinant Human Olfactory receptor 4K17 (OR4K17) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 4K17, Olfactory receptor OR14-29

UniProt

Q8NGC6

Expression Region

1-315

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAMKLLNQSQVSEFILLGLTSSQDVEFLLFALFSVIYVVTVLGNLLIIVTVFNTPNLNT PMYFLLGNLSFVDMTLASFATPKVILNLLKKQKVISFAGCFTQIFLLHLLGGVEMVLLVS MAFDRYVAICKPLHYMTIMNKKVCVLLVVTSWLLGLLHSGFQIPFAVNLPFCGPNVVDSI FCDLPLVTKLACIDIYFVQVVIVANSGIISLSCFIILLISYSLILITIKNHSPTGQSKAR STLTAHITVVILFFGPCIFIYIWPFGNHSVDKFLAVFYTIITPILNPIIYTLRNKEMKIS MKKLWRAFVNSREDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOM1 Protein Vector (Human) (pPB-C-His)
PV043381 500 ng

TOM1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
KLF13 Rabbit pAb
E45R29753N-100 100 µL

KLF13 Rabbit pAb

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Nitric Oxide Synthase 2, Inducible (NOS2)
MBS2143027-01 0.1 mL

FITC-Linked Monoclonal Antibody to Nitric Oxide Synthase 2, Inducible (NOS2)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Nitric Oxide Synthase 2, Inducible (NOS2)
MBS2143027-02 0.2 mL

FITC-Linked Monoclonal Antibody to Nitric Oxide Synthase 2, Inducible (NOS2)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Nitric Oxide Synthase 2, Inducible (NOS2)
MBS2143027-03 0.5 mL

FITC-Linked Monoclonal Antibody to Nitric Oxide Synthase 2, Inducible (NOS2)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Nitric Oxide Synthase 2, Inducible (NOS2)
MBS2143027-04 1 mL

FITC-Linked Monoclonal Antibody to Nitric Oxide Synthase 2, Inducible (NOS2)

Sign In for Pricing
View Details