Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 483 (Olfr483)

This Recombinant Mouse Olfactory receptor 483 (Olfr483) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 483, Olfactory receptor 204-12

UniProt

Q8VG05

Expression Region

1-315

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFLQDGNHTAVTEFILLGLTDDPVLRVVLFTIILCIYLVTVFGNLSTILLIRVSSQLHH PMYFFLSHLASVDIGISSSVTPSMLVNFLLERSTISYLGCGIQLGSADFIASVECFLLAA MAYDRFMAVCNPLLYSTKMSTQVCVQLVVGSYIGGFLNASLIVTVYFFSFLFCGPNRIDH FFCDFAPLAELSCSDVSVSVLIISFSAGSVTMITVFVIVISYSYILITILKMHSTEGRHK AFSTCTSHLTAVTLYYGTITFIYVMPKSSFSTDQNKVVSVFYMVMIPMLNPLIYSLSNNE IKGALKRQLGMKTLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Risankizumab Biosimilar - Research Grade
ICH5210-10mg 10 mg (2x 5 mg)

Risankizumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Tmem120a Mouse Gene Knockout Kit (CRISPR)
KN517705 1 Kit

Tmem120a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KRT27 Human Gene Knockout Kit (CRISPR)
KN421911 1 Kit

KRT27 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DOCK8 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C4]
TA506495AM 100 µL

DOCK8 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C4]

Sign In for Pricing
View Details
TLE 1 (TLE1) (Center) Rabbit Polyclonal Antibody
AP54266PU-N 400 µL

TLE 1 (TLE1) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PLXNB1 Antibody (Biotin)
KB-8195-01 50 μL

PLXNB1 Antibody (Biotin)

Sign In for Pricing
View Details