Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 483 (Olfr483)

This Recombinant Mouse Olfactory receptor 483 (Olfr483) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 483, Olfactory receptor 204-12

UniProt

Q8VG05

Expression Region

1-315

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFLQDGNHTAVTEFILLGLTDDPVLRVVLFTIILCIYLVTVFGNLSTILLIRVSSQLHH PMYFFLSHLASVDIGISSSVTPSMLVNFLLERSTISYLGCGIQLGSADFIASVECFLLAA MAYDRFMAVCNPLLYSTKMSTQVCVQLVVGSYIGGFLNASLIVTVYFFSFLFCGPNRIDH FFCDFAPLAELSCSDVSVSVLIISFSAGSVTMITVFVIVISYSYILITILKMHSTEGRHK AFSTCTSHLTAVTLYYGTITFIYVMPKSSFSTDQNKVVSVFYMVMIPMLNPLIYSLSNNE IKGALKRQLGMKTLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamartin (TSC1) Human Gene Knockout Kit (CRISPR)
KN213332BN 1 Kit

Hamartin (TSC1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS708504 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Biotin Conjugated Rabbit Affinity Purified Antibody to Goat IgG, Fc Specific,
BAF-521-1 1 mL

Biotin Conjugated Rabbit Affinity Purified Antibody to Goat IgG, Fc Specific,

Sign In for Pricing
View Details
[1,2-Bis(diphenylphosphino)ethane]dichloropalladium(II)
TRC-B430490-50MG 50 mg

[1,2-Bis(diphenylphosphino)ethane]dichloropalladium(II)

Sign In for Pricing
View Details
Zic5 Mouse Gene Knockout Kit (CRISPR)
KN520087 1 Kit

Zic5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human OR5AL1 activation kit by CRISPRa
GA112452 1 Kit

Human OR5AL1 activation kit by CRISPRa

Sign In for Pricing
View Details