Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8J3 (OR8J3)

This Recombinant Human Olfactory receptor 8J3 (OR8J3) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 8J3, Olfactory receptor OR11-173

UniProt

Q8NGG0

Expression Region

1-315

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPENFTRVTEFILTGVSSCPELQIPLFLVFLVLYVLTMAGNLGIITLTSVDSRLQNPMY FFLRHLAIINLGNSTVIAPKMLMNFLVKKKTTSFYECATQLGGFLFFIVSEVMMLAVMAY DRYVAICNPLLYMVVVSRRLCLLLVSLTYLYGFSTAIVVSPCIFSVSYCSSNIINHFYCD IAPLLALSCSDTYIPETIVFISAATNLVFSMITVLVSYFNIVLSILRIRSPEGRKKAFST CASHMIAVTVFYGTMLFMYLQPQTNHSLDTDKMASVFYTLVIPMLNPLIYSLRNNDVNVA LKKFMENPCYSFKSM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Espin (ESPN) Human shRNA Plasmid Kit (Locus ID 83715)
TL304734 1 Kit

Espin (ESPN) Human shRNA Plasmid Kit (Locus ID 83715)

Sign In for Pricing
View Details
Rabbit Anti-Human AR-α1D Polyclonal Antibody
PA88812HU-01 50 µg

Rabbit Anti-Human AR-α1D Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human AR-α1D Polyclonal Antibody
PA88812HU-02 100 µg

Rabbit Anti-Human AR-α1D Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human AR-α1D Polyclonal Antibody
PA88812HU-03 500 µg

Rabbit Anti-Human AR-α1D Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human AR-α1D Polyclonal Antibody
PA88812HU-04 1 mg

Rabbit Anti-Human AR-α1D Polyclonal Antibody

Sign In for Pricing
View Details
Human FLT3LG siRNA
abx916983-01 15 nmol

Human FLT3LG siRNA

Sign In for Pricing
View Details