Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8J3 (OR8J3)

This Recombinant Human Olfactory receptor 8J3 (OR8J3) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 8J3, Olfactory receptor OR11-173

UniProt

Q8NGG0

Expression Region

1-315

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPENFTRVTEFILTGVSSCPELQIPLFLVFLVLYVLTMAGNLGIITLTSVDSRLQNPMY FFLRHLAIINLGNSTVIAPKMLMNFLVKKKTTSFYECATQLGGFLFFIVSEVMMLAVMAY DRYVAICNPLLYMVVVSRRLCLLLVSLTYLYGFSTAIVVSPCIFSVSYCSSNIINHFYCD IAPLLALSCSDTYIPETIVFISAATNLVFSMITVLVSYFNIVLSILRIRSPEGRKKAFST CASHMIAVTVFYGTMLFMYLQPQTNHSLDTDKMASVFYTLVIPMLNPLIYSLRNNDVNVA LKKFMENPCYSFKSM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IgE/IGHE Protein, N-His
orb2964086-01 50 µg

Recombinant Human IgE/IGHE Protein, N-His

Sign In for Pricing
View Details
Recombinant Human IgE/IGHE Protein, N-His
orb2964086-02 100 µg

Recombinant Human IgE/IGHE Protein, N-His

Sign In for Pricing
View Details
Recombinant Human IgE/IGHE Protein, N-His
orb2964086-03 1 mg

Recombinant Human IgE/IGHE Protein, N-His

Sign In for Pricing
View Details
STXBP2-set siRNA/shRNA/RNAi Lentivector (Human)
45808091 4x 500 ng

STXBP2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 1 (GFRa1)
MBS2007151-01 0.1 mL

Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 1 (GFRa1)

Sign In for Pricing
View Details
Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 1 (GFRa1)
MBS2007151-02 0.2 mL

Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 1 (GFRa1)

Sign In for Pricing
View Details