Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 11A1 (OR11A1)

This Recombinant Human Olfactory receptor 11A1 (OR11A1) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 11A1, Hs6M1-18, Olfactory receptor 11A2, Olfactory receptor OR6-30

UniProt

Q9GZK7

Expression Region

1-315

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIVSTGNETITEFVLLGFYDIPELHFLFFIVFTAVYVFIIIGNMLIIVAVVSSQRLHKP MYIFLANLSFLDILYTSAVMPKMLEGFLQEATISVAGCLLQFFIFGSLATAECLLLAVMA YDRYLAICYPLHYPLLMGPRRYMGLVVTTWLSGFVVDGLVVALVAQLRFCGPNHIDQFYC DFMLFVGLACSDPRVAQVTTLILSVFCLTIPFGLILTSYARIVVAVLRVPAGASRRRAFS TCSSHLAVVTTFYGTLMIFYVAPSAVHSQLLSKVFSLLYTVVTPLFNPVIYTMRNKEVHQ ALRKILCIKQTETLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAPDHP72 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV762084 1.0 µg DNA

GAPDHP72 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Mouse Mcts1/Malignant T-cell-amplified sequence 1 ELISA Kit
E1657Mo 96 Tests

Mouse Mcts1/Malignant T-cell-amplified sequence 1 ELISA Kit

Sign In for Pricing
View Details
Reagecon Refractive Index Standard (Solvent Based) 1.46768 nD units at 20°C
RI01466 6x 15 mL

Reagecon Refractive Index Standard (Solvent Based) 1.46768 nD units at 20°C

Sign In for Pricing
View Details
Influenza A virus HA/Hemagglutinin Antibody
E55A15614 100 µg

Influenza A virus HA/Hemagglutinin Antibody

Sign In for Pricing
View Details
Hsa-miR-6735-3p miRNA Mimic
orb1876619-01 5 nmol

Hsa-miR-6735-3p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-6735-3p miRNA Mimic
orb1876619-02 10 nmol

Hsa-miR-6735-3p miRNA Mimic

Sign In for Pricing
View Details