Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 11A1 (OR11A1)

This Recombinant Human Olfactory receptor 11A1 (OR11A1) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 11A1, Hs6M1-18, Olfactory receptor 11A2, Olfactory receptor OR6-30

UniProt

Q9GZK7

Expression Region

1-315

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIVSTGNETITEFVLLGFYDIPELHFLFFIVFTAVYVFIIIGNMLIIVAVVSSQRLHKP MYIFLANLSFLDILYTSAVMPKMLEGFLQEATISVAGCLLQFFIFGSLATAECLLLAVMA YDRYLAICYPLHYPLLMGPRRYMGLVVTTWLSGFVVDGLVVALVAQLRFCGPNHIDQFYC DFMLFVGLACSDPRVAQVTTLILSVFCLTIPFGLILTSYARIVVAVLRVPAGASRRRAFS TCSSHLAVVTTFYGTLMIFYVAPSAVHSQLLSKVFSLLYTVVTPLFNPVIYTMRNKEVHQ ALRKILCIKQTETLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P- (diethylamino) benzonitrile 97%
D19960 5 g

P- (diethylamino) benzonitrile 97%

Sign In for Pricing
View Details
COG2 Antibody - N-terminal region : Biotin (ARP54815_P050-Biotin)
ARP54815_P050-Biotin 100 µL

COG2 Antibody - N-terminal region : Biotin (ARP54815_P050-Biotin)

Sign In for Pricing
View Details
MTAP Rabbit mAb
A20907-01 100 μL

MTAP Rabbit mAb

Sign In for Pricing
View Details
MTAP Rabbit mAb
A20907-02 20 µL

MTAP Rabbit mAb

Sign In for Pricing
View Details
MTAP Rabbit mAb
A20907-03 500 μL

MTAP Rabbit mAb

Sign In for Pricing
View Details
MTAP Rabbit mAb
A20907-04 1000 μL

MTAP Rabbit mAb

Sign In for Pricing
View Details