Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gorilla gorilla gorilla Olfactory receptor 3A1 (OR3A1)

This Recombinant Gorilla gorilla gorilla Olfactory receptor 3A1 (OR3A1) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 3A1

UniProt

Q9TU89

Expression Region

1-315

Origin

Gorilla gorilla gorilla (Lowland gorilla)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQPESGANGTVIAEFILLGLLEAPGLQPVVFVLFLFAYLVTVGGNLSILAAVLVEPELHT PMYFFLGNLSVLDVGCISVTVPSMLSRLLSRKRAVPCGACLTQLFFFHLFVGVDCFLLIA MAYDRFLAICRPLTYSTRMSQTVQRMLVAASWACAFTNALTHTVAMSTLNFCGPNVINHF YCDLPQLCQLSCSSTQLSELLLFAVGFIMAGTSMALIVISYIHVAAAVLRIRSVEGRKKA FSTCGSHLTVVAIFYGSGIFNYMRLGSTKLSDKDKAVGIFNTVINPMLNPIIYSFRNPDV QSAIWRMLTGRRSLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDS3 (SUDS3) (NM_022491) Human Over-expression Lysate
LY402929 100 µg

SDS3 (SUDS3) (NM_022491) Human Over-expression Lysate

Sign In for Pricing
View Details
(2,3-Dihydro-1H-indol-6-yl)-carbamic Acid Tert-butyl Ester
TRC-D680338-500MG 500 mg

(2,3-Dihydro-1H-indol-6-yl)-carbamic Acid Tert-butyl Ester

Sign In for Pricing
View Details
Recombinant Human IL-10/Interleukin-10 Protein
PKSH031972 100 µg

Recombinant Human IL-10/Interleukin-10 Protein

Sign In for Pricing
View Details
CD268 / BAFFR / TNFRSF13C (BAFFR/1557), CF488A conjugate, 0.1mg/mL
BNC881557-500 1x 500 µL

CD268 / BAFFR / TNFRSF13C (BAFFR/1557), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BCL10 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B3]
TA800515BM 100 µL

BCL10 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B3]

Sign In for Pricing
View Details
JAK2 pTyr1007 Rabbit Polyclonal Antibody
AP02435PU-S 50 µL

JAK2 pTyr1007 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details