Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vomeronasal type-1 receptor 54 (Vmn1r54)

This Recombinant Mouse Vomeronasal type-1 receptor 54 (Vmn1r54) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Vomeronasal type-1 receptor 54, Pheromone receptor VN7, Vomeronasal receptor 7, Vomeronasal type-1 receptor A9

UniProt

Q9EPB8

Expression Region

1-315

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKMNRLSHNTEIRNAIYSGVGIGISGNSFLLLFHIFKYIRGQRSRHIDLPIGLLSLIHL VMLIAMSLVATDIFMPWGRWGDTTCKCVISLYRFCRSLSLCATSLLSILQAVTLNPRNSC LEKFKRKSPHYMLGCLLFLSVFYTFISSPLATYITAKSNLTSPSFTYITTSCSLAPMSYS FHLTVFILLTSRDVIFVGLMLLSSGYMVTFLGRHKKQSQFLHITSFSLKPSAEKRAMRTI LCLMSFFVLMYTLDSIVSYIRSIDDGQIFYCVHIFTAHGYATVSPFLILSTEKYIINIFR STFGRMVTIILLRNR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AfiI, 500U
RV1116 500 U

AfiI, 500U

Sign In for Pricing
View Details
Factor I (CFI) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H9]
TA805898AM 100 µL

Factor I (CFI) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H9]

Sign In for Pricing
View Details
Ceramide synthase 1 (CERS1) (Cross reacts with GDF1) Rabbit Polyclonal Antibody
AP05285PU-N 100 µg

Ceramide synthase 1 (CERS1) (Cross reacts with GDF1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Monoamine Oxidase B Antibody
RC-15941-01 50 μL

Recombinant Monoamine Oxidase B Antibody

Sign In for Pricing
View Details
Recombinant Monoamine Oxidase B Antibody
RC-15941-02 100 µL

Recombinant Monoamine Oxidase B Antibody

Sign In for Pricing
View Details
Recombinant Monoamine Oxidase B Antibody
RC-15941-03 1 mL

Recombinant Monoamine Oxidase B Antibody

Sign In for Pricing
View Details