Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 10A4 (OR10A4)

This Recombinant Human Olfactory receptor 10A4 (OR10A4) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 10A4, HP2, Olfactory receptor-like protein JCG5

UniProt

Q9H209

Expression Region

1-315

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMWENWTIVSEFVLVSFSALSTELQALLFLLFLTIYLVTLMGNVLIILVTIADSALQSPM YFFLRNLSFLEIGFNLVIVPKMLGTLIIQDTTISFLGCATQMYFFFFFGAAECCLLATMA YDRYVAICDPLHYPVIMGHISCAQLAAASWFSGFSVATVQTTWIFSFPFCGPNRVNHFFC DSPPVIALVCADTSVFELEALTATVLFILFPFLLILGSYVRILSTIFRMPSAEGKHQAFS TCSAHLLVVSLFYSTAILTYFRPQSSASSESKKLLSLSSTVVTPMLNPIIYSSRNKEVKA ALKRLIHRTLGSQKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASQ2 (NM_001232) Human Over-expression Lysate
LC400493 20 µg

CASQ2 (NM_001232) Human Over-expression Lysate

Sign In for Pricing
View Details
Horizontal Laminar Airflow BLHZ-205
BLHZ-205 Each

Horizontal Laminar Airflow BLHZ-205

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2818R), CF647 conjugate, 0.1mg/mL
BNC472818-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2818R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (OCA1/812), CF640R conjugate, 0.1mg/mL
BNC400812-100 1x 100 µL

Tyrosinase (OCA1/812), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Myometrium
CR559539 5 µg

Tissue Total RNA, Myometrium

Sign In for Pricing
View Details
Calcium Malate
TRC-C145755-500MG 500 mg

Calcium Malate

Sign In for Pricing
View Details