Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 51M1 (OR51M1)

This Recombinant Human Olfactory receptor 51M1 (OR51M1) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 51M1, Odorant receptor HOR5'beta7, Olfactory receptor OR11-40

UniProt

Q9H341

Expression Region

1-315

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLSNITQFSPIFYLTSFPGLEGIKHWIFIPFFFMYMVAISGNCFILIIIKTNPRLHTPM YYLLSLLALTDLGLCVSTLPTTMGIFWFNSQSIYFGACQIQMFCIHSFSFMESSVLLMMS FDRFVAICHPLRYSVIITGQQVVRAGLIVIFRGPVATIPIVLLLKAFPYCGSVVLSHSFC LHQEVIQLACTDTTFNNLYGLMVVVFTVMLDLVLIALSYGLILHTVAGLASQEEQRRAFQ TCTAHLCAVLVFFVPMMGLSLVHRFGKHAPPAIHLLMANVYLFVPPMLNPIIYSIKTKEI HRAIIKLLGLKKASK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DALRD3 activation kit by CRISPRa
GA110557 1 Kit

Human DALRD3 activation kit by CRISPRa

Sign In for Pricing
View Details
OR51A7 (NM_001004749) Human Over-expression Lysate
LY423932 100 µg

OR51A7 (NM_001004749) Human Over-expression Lysate

Sign In for Pricing
View Details
ARL2BP Rabbit Polyclonal Antibody
TA366126 100 µL

ARL2BP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fructose-leucine (Mixture of Diastereomers)
TRC-F792540-25MG 25 mg

Fructose-leucine (Mixture of Diastereomers)

Sign In for Pricing
View Details
Human ASB3 activation kit by CRISPRa
GA109592 1 Kit

Human ASB3 activation kit by CRISPRa

Sign In for Pricing
View Details
Tfg Mouse Gene Knockout Kit (CRISPR)
KN517472 1 Kit

Tfg Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details