Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes Olfactory receptor 3A3 (OR3A3)

This Recombinant Pan troglodytes Olfactory receptor 3A3 (OR3A3) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 3A3

UniProt

Q9TUA0

Expression Region

1-315

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESEAGTNRTAVAEFMLLGLVQTEEMQSVIFVLLLFAYLVTTGGNLSILAAILVEPKLHT PMYFFLGNLSVLDVGCITVTVPAMLGRLLSHKSTISYDACLSQLFFFHLLAGMDCFLLTA MAYDRFLAICRPLTYSTHMNQRVQRMLVAVSWTCAFTNALTHTIALTTLNFCGPSVINHF YCDLPQLFQLSCSSTQLNELLLFVAAAVMAVAPLVFISVSYAHVVAAVLQIHSAEGRKKA FSTCGSHLTVVGIFYGTGVFSYMRLGSVESSDKDKGVGVFMTVINPMLNPLIYSLRNTDV QGALCQLLVVKRSLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYO1A 3'UTR GFP Stable Cell Line
TU065077 1.0 mL

MYO1A 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal anti-Mouse/Rat CD62E (E-selectin) Antibody
xAP-0854 100 µg

Mouse Monoclonal anti-Mouse/Rat CD62E (E-selectin) Antibody

Sign In for Pricing
View Details
APC/iFluor® 750 Anti-mouse CD197 Antibody *4B12*
119701F2-AAT 500 Tests

APC/iFluor® 750 Anti-mouse CD197 Antibody *4B12*

Sign In for Pricing
View Details
HPV33 E7 Rabbit Polyclonal Antibody (BF680)
orb2433563 100 µL

HPV33 E7 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Guinea Pig Amine oxidase [flavin-containing] B (MAOB) ELISA Kit
GTR10328060 96 Well

Guinea Pig Amine oxidase [flavin-containing] B (MAOB) ELISA Kit

Sign In for Pricing
View Details
Cytochrome P450 2B6 Antibody
DF3574-01 100 µL

Cytochrome P450 2B6 Antibody

Sign In for Pricing
View Details