Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes Olfactory receptor 3A3 (OR3A3)

This Recombinant Pan troglodytes Olfactory receptor 3A3 (OR3A3) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 3A3

UniProt

Q9TUA0

Expression Region

1-315

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESEAGTNRTAVAEFMLLGLVQTEEMQSVIFVLLLFAYLVTTGGNLSILAAILVEPKLHT PMYFFLGNLSVLDVGCITVTVPAMLGRLLSHKSTISYDACLSQLFFFHLLAGMDCFLLTA MAYDRFLAICRPLTYSTHMNQRVQRMLVAVSWTCAFTNALTHTIALTTLNFCGPSVINHF YCDLPQLFQLSCSSTQLNELLLFVAAAVMAVAPLVFISVSYAHVVAAVLQIHSAEGRKKA FSTCGSHLTVVGIFYGTGVFSYMRLGSVESSDKDKGVGVFMTVINPMLNPLIYSLRNTDV QGALCQLLVVKRSLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP5A1 Rabbit Polyclonal Antibody
E10G30539 100 µL

ATP5A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Gpr152 qPCR Primer Pair
QM68754S 200 Tests

Mouse Gpr152 qPCR Primer Pair

Sign In for Pricing
View Details
Mouse Monoclonal IL-2 Antibody (100312) [mFluor Violet 500 SE]
FAB6521MFV500 0.1 mL

Mouse Monoclonal IL-2 Antibody (100312) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Anti-IKAP Antibody FITC
STJ501415 100 µg

Anti-IKAP Antibody FITC

Sign In for Pricing
View Details
β-defensin 40 shRNA (m) Lentiviral Particles
sc-142978-V 200 µL

β-defensin 40 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
EG545989 (m) -PR
sc-143706-PR 10 µM - 20 µL

EG545989 (m) -PR

Sign In for Pricing
View Details