Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes Olfactory receptor 3A3 (OR3A3)

This Recombinant Pan troglodytes Olfactory receptor 3A3 (OR3A3) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 3A3

UniProt

Q9TUA0

Expression Region

1-315

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESEAGTNRTAVAEFMLLGLVQTEEMQSVIFVLLLFAYLVTTGGNLSILAAILVEPKLHT PMYFFLGNLSVLDVGCITVTVPAMLGRLLSHKSTISYDACLSQLFFFHLLAGMDCFLLTA MAYDRFLAICRPLTYSTHMNQRVQRMLVAVSWTCAFTNALTHTIALTTLNFCGPSVINHF YCDLPQLFQLSCSSTQLNELLLFVAAAVMAVAPLVFISVSYAHVVAAVLQIHSAEGRKKA FSTCGSHLTVVGIFYGTGVFSYMRLGSVESSDKDKGVGVFMTVINPMLNPLIYSLRNTDV QGALCQLLVVKRSLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IgT Antibody (Z55F8*C3) [CoraFluor 1]
NBP2-61127CL1 0.1 mL

Mouse Monoclonal IgT Antibody (Z55F8*C3) [CoraFluor 1]

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi B Glycerol-3-phosphate acyltransferase (plsY)
MBS1043658 Inquire

Recombinant Salmonella paratyphi B Glycerol-3-phosphate acyltransferase (plsY)

Sign In for Pricing
View Details
Fam46c 3'UTR Lenti-reporter-Luc Vector
20033086 1.0 µg

Fam46c 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Cadherin 10 Rabbit mAb Antibody
orb1950380-01 50 µL

Cadherin 10 Rabbit mAb Antibody

Sign In for Pricing
View Details
Cadherin 10 Rabbit mAb Antibody
orb1950380-02 100 µL

Cadherin 10 Rabbit mAb Antibody

Sign In for Pricing
View Details
Rat Monoclonal 4-1BB/TNFRSF9/CD137 Antibody (JG1.6A) [PE/Cy7]
NB100-64306PECY7 0.1 mL

Rat Monoclonal 4-1BB/TNFRSF9/CD137 Antibody (JG1.6A) [PE/Cy7]

Sign In for Pricing
View Details