Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes Olfactory receptor 3A1 (OR3A1)

This Recombinant Pan troglodytes Olfactory receptor 3A1 (OR3A1) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 3A1

UniProt

Q9TUA4

Expression Region

1-315

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQPESGANGTVIAEFILLGLLEAPGLQPVVFVLFLFAYLVTVGGNLSILAAVLVEPKLHS PMYFFLGNLSVLDVGCISVTVPSMLSRLLSRKRAVPCGACLTQLFFFHLFVGVDCFLLTA MAYDRFLAICRPLTYSTRMSQTVQRMLVAASWACAFTNALTHTVAMSTLNFCGPNEVNHF YCDLPQLFQLSCSSTQLNELLLFAVGFIMAGTPMALIVISYIHVAAAVLRIRSVEGRKKA FSTCGSHLTVVAMFYGSGIFNYMRLGSTKLSDKDKAVGIFNTVINPMVNPIIYRFRNPEV QSAIWRMLTGRRSLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNAB1 Antibody
orb1322463-01 30 µL

KCNAB1 Antibody

Sign In for Pricing
View Details
KCNAB1 Antibody
orb1322463-02 50 μL

KCNAB1 Antibody

Sign In for Pricing
View Details
KCNAB1 Antibody
orb1322463-03 100 µL

KCNAB1 Antibody

Sign In for Pricing
View Details
ELAVL1 antibody
MBS532945-01 0.1 mL

ELAVL1 antibody

Sign In for Pricing
View Details
ELAVL1 antibody
MBS532945-02 5x 0.1 mL

ELAVL1 antibody

Sign In for Pricing
View Details
Lentiviral human CRYL1 sgRNA gene knockout kit - Lentiviral human CRYL1 sgRNA gene knockout kit (25)
GTR15385818 1 Vial

Lentiviral human CRYL1 sgRNA gene knockout kit - Lentiviral human CRYL1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details